Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria clfA protein

This Bacteria clfA protein spans the amino acid sequence from region 229-559aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen receptor A (Fibrinogen-binding protein A)

UniProt

Q5HHM8

Expression Region

229-559aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC4 Monoclonal Antibody, Cy5 Conjugated
bsm-52085R-Cy5 100 µL

HDAC4 Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit Anti-RSPO3 Polyclonal Antibody
PAV3487 100 μL

Rabbit Anti-RSPO3 Polyclonal Antibody

Sign In for Pricing
View Details
2- (4-Methylphenyl) -1,3-oxazole-4-carbaldehyde
FCA32730-01 50 mg

2- (4-Methylphenyl) -1,3-oxazole-4-carbaldehyde

Sign In for Pricing
View Details
2- (4-Methylphenyl) -1,3-oxazole-4-carbaldehyde
FCA32730-02 0.5 g

2- (4-Methylphenyl) -1,3-oxazole-4-carbaldehyde

Sign In for Pricing
View Details
CEA Monoclonal Antibody (Detection)
orb25861 1 mg

CEA Monoclonal Antibody (Detection)

Sign In for Pricing
View Details
4933407C03Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4692507 1.0 µg DNA

4933407C03Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details