Mouse Pla2g12a protein
This Mouse Pla2g12a protein spans the amino acid sequence from region 26-192aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (Pla2g12)
UniProt
Q9EPR2
Expression Region
26-192aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A15133-iFluor647 100 µg
Anti-METTL18 Antibody Picoband®, iFluor647 Conjugate
Sign In for Pricing
View Details 
GTR15388313 1 Vial
Lentiviral human RALGAPA1 sgRNA gene knockout kit - Lentiviral human RALGAPA1 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
MBS6282960-01 0.2 mL
CD226, CT (CD226, DNAM1, CD226 antigen, DNAX accessory molecule 1, CD226) (AP)
Sign In for Pricing
View Details MBS6282960-02 5x 0.2 mL
CD226, CT (CD226, DNAM1, CD226 antigen, DNAX accessory molecule 1, CD226) (AP)
Sign In for Pricing
View Details