Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A33R protein

This Virus A33R protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

A33RProtein A33

UniProt

P68616

Expression Region

57-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBF-1 (Nucleolar Transcription Factor 1, Autoantigen NOR-90, Upstream-Binding Factor 1, UBF-1, UBTF, UBF, UBF1) discontinued
226563-01 50 µL

UBF-1 (Nucleolar Transcription Factor 1, Autoantigen NOR-90, Upstream-Binding Factor 1, UBF-1, UBTF, UBF, UBF1) discontinued

Sign In for Pricing
View Details
UBF-1 (Nucleolar Transcription Factor 1, Autoantigen NOR-90, Upstream-Binding Factor 1, UBF-1, UBTF, UBF, UBF1) discontinued
226563-02 100 µL

UBF-1 (Nucleolar Transcription Factor 1, Autoantigen NOR-90, Upstream-Binding Factor 1, UBF-1, UBTF, UBF, UBF1) discontinued

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)
MBS1027905-01 0.02 mg (E-Coli)

Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)
MBS1027905-02 0.1 mg (E-Coli)

Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)
MBS1027905-03 0.02 mg (Baculovirus)

Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)
MBS1027905-04 0.02 mg (Mammalian-Cell)

Recombinant Arcobacter butzleri Tetraacyldisaccharide 4'-kinase (lpxK)

Sign In for Pricing
View Details