Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A33R protein

This Virus A33R protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

A33RProtein A33

UniProt

P68616

Expression Region

57-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal mouse MMR Antibody
orb1408220-01 100 µg

Rat Monoclonal mouse MMR Antibody

Sign In for Pricing
View Details
Rat Monoclonal mouse MMR Antibody
orb1408220-02 50 µg

Rat Monoclonal mouse MMR Antibody

Sign In for Pricing
View Details
Anti-TRAF7 Antibody Picoband®, Cy3 Conjugate
A05972-1-Cy3 100 µg/Vial

Anti-TRAF7 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Anti-MPP5/PALS1 Antibody Picoband® PE Conjugated
A05311-2-PE 100 µg/Vial

Anti-MPP5/PALS1 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
DNA-binding protein Inhibitor ID-4 (ID4) Porcine ELISA Kit
C9565 96 Tests

DNA-binding protein Inhibitor ID-4 (ID4) Porcine ELISA Kit

Sign In for Pricing
View Details
TFB1M Mouse Monoclonal Antibody [Clone ID: OTI11H1]
TA804100 100 µL

TFB1M Mouse Monoclonal Antibody [Clone ID: OTI11H1]

Sign In for Pricing
View Details