Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus ACB1 protein

This Virus ACB1 protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, ACBP

UniProt

P31787

Expression Region

1-87aa

Tag

Tag-Free

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF541 CRISPR Activation Plasmid (m2)
sc-437098-ACT-2 20 µg

ZNF541 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
LCP1 (Lymphocyte Cytosolic Protein 1, LPL, CP64, PLS2, LC64P, L-PLASTIN) (MaxLight 750)
MBS6424547-01 0.1 mL

LCP1 (Lymphocyte Cytosolic Protein 1, LPL, CP64, PLS2, LC64P, L-PLASTIN) (MaxLight 750)

Sign In for Pricing
View Details
LCP1 (Lymphocyte Cytosolic Protein 1, LPL, CP64, PLS2, LC64P, L-PLASTIN) (MaxLight 750)
MBS6424547-02 5x 0.1 mL

LCP1 (Lymphocyte Cytosolic Protein 1, LPL, CP64, PLS2, LC64P, L-PLASTIN) (MaxLight 750)

Sign In for Pricing
View Details
PANX3 Antibody
A63296-100UG 100 µg

PANX3 Antibody

Sign In for Pricing
View Details
Cenpm ORF Vector (Mouse) (pORF)
ORF041168 1.0 µg DNA

Cenpm ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Aluminum Iodide
A0700 5 g

Aluminum Iodide

Sign In for Pricing
View Details