Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria omp protein

This Bacteria omp protein spans the amino acid sequence from region 20-159aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omp17 kDa surface antigen

UniProt

P0A3N5

Expression Region

20-159aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rickettsia rickettsii

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGKGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMPR1A Antibody, HRP conjugated
MBS1495848-01 0.05 mg

BMPR1A Antibody, HRP conjugated

Sign In for Pricing
View Details
BMPR1A Antibody, HRP conjugated
MBS1495848-02 0.1 mg

BMPR1A Antibody, HRP conjugated

Sign In for Pricing
View Details
BMPR1A Antibody, HRP conjugated
MBS1495848-03 5x 0.1 mg

BMPR1A Antibody, HRP conjugated

Sign In for Pricing
View Details
Rifampicin Impurity 33
RM-R027033-01 10 mg

Rifampicin Impurity 33

Sign In for Pricing
View Details
Rifampicin Impurity 33
RM-R027033-02 25 mg

Rifampicin Impurity 33

Sign In for Pricing
View Details
Rifampicin Impurity 33
RM-R027033-03 50 mg

Rifampicin Impurity 33

Sign In for Pricing
View Details