Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus env protein

This Virus env protein spans the amino acid sequence from region 21-312aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Env polyprotein

UniProt

P03381

Expression Region

21-312aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mark4 Antibody - C-terminal region
OAAB11477-400UL 400 µL

Mouse Mark4 Antibody - C-terminal region

Sign In for Pricing
View Details
Mouse Anti-Histidine rich glycoprotein II (HRP II, P. falciparum) IgG clone 32
HRPF22-M 100 µg

Mouse Anti-Histidine rich glycoprotein II (HRP II, P. falciparum) IgG clone 32

Sign In for Pricing
View Details
Hamster Protein MEMO1 (MEMO1) ELISA Kit
MBS9351400-01 48 Well

Hamster Protein MEMO1 (MEMO1) ELISA Kit

Sign In for Pricing
View Details
Hamster Protein MEMO1 (MEMO1) ELISA Kit
MBS9351400-02 96 Well

Hamster Protein MEMO1 (MEMO1) ELISA Kit

Sign In for Pricing
View Details
Hamster Protein MEMO1 (MEMO1) ELISA Kit
MBS9351400-03 5x 96 Well

Hamster Protein MEMO1 (MEMO1) ELISA Kit

Sign In for Pricing
View Details
Hamster Protein MEMO1 (MEMO1) ELISA Kit
MBS9351400-04 10x 96 Well

Hamster Protein MEMO1 (MEMO1) ELISA Kit

Sign In for Pricing
View Details