Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus env protein

This Virus env protein spans the amino acid sequence from region 21-312aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Env polyprotein

UniProt

P03381

Expression Region

21-312aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HIC1 Antibody (1F2)
H00003090-M05 0.1 mg

Mouse Monoclonal HIC1 Antibody (1F2)

Sign In for Pricing
View Details
Goat Exendin 4 ELISA Kit
MBS734812-01 48 Well

Goat Exendin 4 ELISA Kit

Sign In for Pricing
View Details
Goat Exendin 4 ELISA Kit
MBS734812-02 96 Well

Goat Exendin 4 ELISA Kit

Sign In for Pricing
View Details
Goat Exendin 4 ELISA Kit
MBS734812-03 5x 96 Well

Goat Exendin 4 ELISA Kit

Sign In for Pricing
View Details
Goat Exendin 4 ELISA Kit
MBS734812-04 10x 96 Well

Goat Exendin 4 ELISA Kit

Sign In for Pricing
View Details
FA2H Polyclonal Antibody
MBS9246687-01 0.1 mL

FA2H Polyclonal Antibody

Sign In for Pricing
View Details