Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Chicken Antimicrobial peptide CHP1 protein

This Insect Chicken Antimicrobial peptide CHP1 protein spans the amino acid sequence from region 34-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Api m I (Phosphatidylcholine 2-acylhydrolase) (Allergen, Api m 1) (bvPLA2)

UniProt

P00630

Expression Region

34-167aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Apis mellifera (Honeybee)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 Recombinant Rabbit Monoclonal Antibody [SY34-01]
ET1605-45 100 µL

STAT3 Recombinant Rabbit Monoclonal Antibody [SY34-01]

Sign In for Pricing
View Details
CD130 (IL6ST) Mouse Monoclonal Antibody [Clone ID: B-S12]
AM31178AF-N 200 µg

CD130 (IL6ST) Mouse Monoclonal Antibody [Clone ID: B-S12]

Sign In for Pricing
View Details
3,4,5-Trichlorocatechol
TRC-T773925-50MG 50 mg

3,4,5-Trichlorocatechol

Sign In for Pricing
View Details
EGFR Recombinant Rabbit monoclonal Antibody
HA750078 100 µL

EGFR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CytoTrace™ Green CMFDA
22017-AAT 1 mg

CytoTrace™ Green CMFDA

Sign In for Pricing
View Details
HDAC9 Rabbit Monoclonal Antibody [Clone ID: 23GB2045]
TA424856 100 µL

HDAC9 Rabbit Monoclonal Antibody [Clone ID: 23GB2045]

Sign In for Pricing
View Details