Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Chicken Antimicrobial peptide CHP1 protein

This Insect Chicken Antimicrobial peptide CHP1 protein spans the amino acid sequence from region 34-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Api m I (Phosphatidylcholine 2-acylhydrolase) (Allergen, Api m 1) (bvPLA2)

UniProt

P00630

Expression Region

34-167aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Apis mellifera (Honeybee)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTX3 Adenovirus (Rat)
38202056 1.0 mL

PTX3 Adenovirus (Rat)

Sign In for Pricing
View Details
MRPL39, CT (MRPL39, C21orf92, MRPL5, RPML5, 39S ribosomal protein L39, mitochondrial, 39S ribosomal protein L5, mitochondrial) (AP) discontinued
038595-AP 200 µL

MRPL39, CT (MRPL39, C21orf92, MRPL5, RPML5, 39S ribosomal protein L39, mitochondrial, 39S ribosomal protein L5, mitochondrial) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein
MBS1041818-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein
MBS1041818-02 0.1 mg (E-Coli)

Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein
MBS1041818-03 0.02 mg (Yeast)

Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein
MBS1041818-04 0.1 mg (Yeast)

Recombinant Francisella tularensis subsp. novicida Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details