Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus G protein

This Virus G protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GGlycoprotein

UniProt

P03524

Expression Region

20-459aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rabies virus (strain ERA) (RABV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO3 (LIM Domain only 3 (rhombotin-like 2), DAT1, MGC26081, RBTN3, RBTNL2, RHOM3, Rhom-3) (MaxLight 490)
248231-ML490 100 µL

LMO3 (LIM Domain only 3 (rhombotin-like 2), DAT1, MGC26081, RBTN3, RBTNL2, RHOM3, Rhom-3) (MaxLight 490)

Sign In for Pricing
View Details
Phosphos-PCNA (Tyr211) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2215R-APC-Cy5.5 100 µL

Phosphos-PCNA (Tyr211) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
ACVRL1 Antibody, Biotin conjugated
CSB-PA00839D0Rb-01 50 µg

ACVRL1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ACVRL1 Antibody, Biotin conjugated
CSB-PA00839D0Rb-02 100 µg

ACVRL1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Selectin, Endothelium (SELE)
MBS2035413-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Selectin, Endothelium (SELE)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Selectin, Endothelium (SELE)
MBS2035413-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Selectin, Endothelium (SELE)

Sign In for Pricing
View Details