Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LANCL1 protein

This Human LANCL1 protein spans the amino acid sequence from region 2-399aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

40 kDa erythrocyte membrane protein (p40) (GPR69A)

UniProt

O43813

Expression Region

2-399aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pack of 250 Sheets of Medium Qualitative Filter, 77X228 Mm
QL03F0823Z Pack of 250

Pack of 250 Sheets of Medium Qualitative Filter, 77X228 Mm

Sign In for Pricing
View Details
Recombinant Tupaia chinensis CD47/MER6 Protein, N-His
orb3151027-01 50 µg

Recombinant Tupaia chinensis CD47/MER6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Tupaia chinensis CD47/MER6 Protein, N-His
orb3151027-02 100 µg

Recombinant Tupaia chinensis CD47/MER6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Tupaia chinensis CD47/MER6 Protein, N-His
orb3151027-03 1 mg

Recombinant Tupaia chinensis CD47/MER6 Protein, N-His

Sign In for Pricing
View Details
Rabbit Polyclonal AC011484.2 Antibody [Alexa Fluor 350]
NBP3-06547AF350 0.1 mL

Rabbit Polyclonal AC011484.2 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Rat ALK-7 Biotinylated Affinity Purified PAb
BAF577 50 µg

Rat ALK-7 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details