Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LANCL1 protein

This Human LANCL1 protein spans the amino acid sequence from region 2-399aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

40 kDa erythrocyte membrane protein (p40) (GPR69A)

UniProt

O43813

Expression Region

2-399aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Condylura cristata Cytochrome b (MT-CYB), partial
MBS7091791 Inquire

Recombinant Condylura cristata Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
7-Hydroxyquinoline-3-carboxylic acid HBr
JBB73027-01 100 mg

7-Hydroxyquinoline-3-carboxylic acid HBr

Sign In for Pricing
View Details
7-Hydroxyquinoline-3-carboxylic acid HBr
JBB73027-02 1 g

7-Hydroxyquinoline-3-carboxylic acid HBr

Sign In for Pricing
View Details
Olfr984 Double Nickase Plasmid (m2)
sc-434730-NIC-2 20 µg

Olfr984 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
DR4, NT (TRAIL R1, TRAIL Receptor1, Death Receptor4) (PE)
MBS6472966-01 0.1 mL

DR4, NT (TRAIL R1, TRAIL Receptor1, Death Receptor4) (PE)

Sign In for Pricing
View Details
DR4, NT (TRAIL R1, TRAIL Receptor1, Death Receptor4) (PE)
MBS6472966-02 5x 0.1 mL

DR4, NT (TRAIL R1, TRAIL Receptor1, Death Receptor4) (PE)

Sign In for Pricing
View Details