Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LANCL1 protein

This Human LANCL1 protein spans the amino acid sequence from region 2-399aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

40 kDa erythrocyte membrane protein (p40) (GPR69A)

UniProt

O43813

Expression Region

2-399aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SHMT1 Antibody [Alexa Fluor 594]
NBP3-21429AF594 0.1 mL

Rabbit Polyclonal SHMT1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Recombinant Greasy grouper nervous necrosis virus RNA-directed RNA polymerase, partial
MBS1387083 Inquire

Recombinant Greasy grouper nervous necrosis virus RNA-directed RNA polymerase, partial

Sign In for Pricing
View Details
THAP9 discontinued
395353 200 µL

THAP9 discontinued

Sign In for Pricing
View Details
ZNF645 Rabbit Polyclonal Antibody (Biotin)
orb453791 100 µL

ZNF645 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant ICAM3 Antibody
orb2642701 7 mL

Recombinant ICAM3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TRAILR4/TNFRSF10D/DcR2 Antibody [PE]
NBP1-76985PE 0.1 mL

Rabbit Polyclonal TRAILR4/TNFRSF10D/DcR2 Antibody [PE]

Sign In for Pricing
View Details