Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dectin-1/CLEC7A, Human (HEK293, Fc)

The Dectin-1/CLEC7A protein is a lectin and pattern recognition receptor that targets β-1,3- and β-1,6-linked glucans in bacterial and fungal cell walls. It triggers Toll-like receptor 2 (TLR2) -mediated inflammation by recruiting splenic tyrosine kinase (SYK) and activating the CARD domain-BCL10-MALT1 (CBM) signalosome. Dectin-1/CLEC7A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Dectin-1/CLEC7A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dectin-1-clec7a-protein-human-hek-293-fc.html

Purity

98.00

Smiles

TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM

Molecular Formula

64581 (Gene_ID) Q9BXN2-1 (T66-M247) (Accession)

Molecular Weight

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-500 1x 500 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details