Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dectin-1/CLEC7A, Human (HEK293, Fc)

The Dectin-1/CLEC7A protein is a lectin and pattern recognition receptor that targets β-1,3- and β-1,6-linked glucans in bacterial and fungal cell walls. It triggers Toll-like receptor 2 (TLR2) -mediated inflammation by recruiting splenic tyrosine kinase (SYK) and activating the CARD domain-BCL10-MALT1 (CBM) signalosome. Dectin-1/CLEC7A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Dectin-1/CLEC7A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dectin-1-clec7a-protein-human-hek-293-fc.html

Purity

98.00

Smiles

TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM

Molecular Formula

64581 (Gene_ID) Q9BXN2-1 (T66-M247) (Accession)

Molecular Weight

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ranatensin
sc-391167A 5 mg

Ranatensin

Sign In for Pricing
View Details
Growth Hormone 2 (GH2) Monkey ELISA Kit
D6781 96 Tests

Growth Hormone 2 (GH2) Monkey ELISA Kit

Sign In for Pricing
View Details
AMH, Recombinant, His-Tag (Anti Mullerian Hormone) discontinued
377678 100 µg

AMH, Recombinant, His-Tag (Anti Mullerian Hormone) discontinued

Sign In for Pricing
View Details
MASA, Recombinant, Human, aa1-261, His-Tag
M2412-21H 100 µg

MASA, Recombinant, Human, aa1-261, His-Tag

Sign In for Pricing
View Details
Anti-VSV-G tag Antibody (6Q246)
TMAB-14147-01 50 μL

Anti-VSV-G tag Antibody (6Q246)

Sign In for Pricing
View Details
Anti-VSV-G tag Antibody (6Q246)
TMAB-14147-02 100 µL

Anti-VSV-G tag Antibody (6Q246)

Sign In for Pricing
View Details