Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YWHAZ protein

This Human YWHAZ protein spans the amino acid sequence from region 133-212aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C inhibitor protein 1 (KCIP-1)

UniProt

P63104

Expression Region

133-212aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100361238 3'UTR Luciferase Stable Cell Line
TU207886 1.0 mL

LOC100361238 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PLEC Protein Vector (Mouse) (pPM-C-His)
PV216997 500 ng

PLEC Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ABCB5 Polyclonal Antibody
MBS2562016-01 0.02 mL

ABCB5 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB5 Polyclonal Antibody
MBS2562016-02 0.06 mL

ABCB5 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB5 Polyclonal Antibody
MBS2562016-03 0.12 mL

ABCB5 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB5 Polyclonal Antibody
MBS2562016-04 0.2 mL

ABCB5 Polyclonal Antibody

Sign In for Pricing
View Details