Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YWHAZ protein

This Human YWHAZ protein spans the amino acid sequence from region 133-212aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C inhibitor protein 1 (KCIP-1)

UniProt

P63104

Expression Region

133-212aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREML4-set siRNA/shRNA/RNAi Lentivector (Human)
47706091 4x 500 ng

TREML4-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
MAP3K14/NFkB Inducing Kinase Polyclonal Antibody, PE-Cy5 Conjugated
bs-0074R-PE-Cy5 100 µL

MAP3K14/NFkB Inducing Kinase Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Thioredoxin 2 (TXN2) Antibody
abx008219-01 30 µL

Thioredoxin 2 (TXN2) Antibody

Sign In for Pricing
View Details
Thioredoxin 2 (TXN2) Antibody
abx008219-02 100 µL

Thioredoxin 2 (TXN2) Antibody

Sign In for Pricing
View Details
Thioredoxin 2 (TXN2) Antibody
abx008219-03 200 µL

Thioredoxin 2 (TXN2) Antibody

Sign In for Pricing
View Details
Sg V siRNA (m)
sc-76490 10 µM

Sg V siRNA (m)

Sign In for Pricing
View Details