Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mup11 protein

This Mouse Mup11 protein spans the amino acid sequence from region 32-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mup9

UniProt

P04938

Expression Region

32-181aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCR discontinued
538823-01 30ul

MCR discontinued

Sign In for Pricing
View Details
MCR discontinued
538823-02 100 µL

MCR discontinued

Sign In for Pricing
View Details
Human O-6-Methylguanine DNA Methyltransferase (MGMT) ELISA Kit
BSKH63848-01 48 Tests

Human O-6-Methylguanine DNA Methyltransferase (MGMT) ELISA Kit

Sign In for Pricing
View Details
Human O-6-Methylguanine DNA Methyltransferase (MGMT) ELISA Kit
BSKH63848-02 96 Tests

Human O-6-Methylguanine DNA Methyltransferase (MGMT) ELISA Kit

Sign In for Pricing
View Details
PCDHB6 293 Cell Lysate
402364 0.1 mg

PCDHB6 293 Cell Lysate

Sign In for Pricing
View Details
Recombinant Human ITGB3BP Protein
E30P7688 20 µg

Recombinant Human ITGB3BP Protein

Sign In for Pricing
View Details