Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mup11 protein

This Mouse Mup11 protein spans the amino acid sequence from region 32-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mup9

UniProt

P04938

Expression Region

32-181aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hsd3b5 (NM_008295) AAV Particle
MR205786A1V 250 µL

Mouse Hsd3b5 (NM_008295) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal PTPIP51 Antibody [Janelia Fluor 549]
NBP1-47293JF549 0.1 mL

Rabbit Polyclonal PTPIP51 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
GENLISA Rat Carbonic Anhydrase 1 ELISA
KLR2717 1x 96 Well

GENLISA Rat Carbonic Anhydrase 1 ELISA

Sign In for Pricing
View Details
Human Leukocyte IFN (native)
HC99920LC 1 mg

Human Leukocyte IFN (native)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Hepcidin (Hepc)
MBS2061469-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Hepcidin (Hepc)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Hepcidin (Hepc)
MBS2061469-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Hepcidin (Hepc)

Sign In for Pricing
View Details