Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus HN protein

This Virus HN protein spans the amino acid sequence from region 152-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HN, Hemagglutinin-neuraminidase, EC 3.2.1.18

UniProt

P11235

Expression Region

152-360aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mumps virus (strain Miyahara vaccine) (MuV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YATHDFSIGHPLNMPSFIPTATSPNGCTRIPSFSLGKTHWCYTHNVINANCKDHTSSNQYISMGILVQTASGYPMFKTLKIQYLSDGLNRKSCSIATVPDGCAMYCYVSTQLETDDYAGSSPPTQKLTLLFYNDTVTERTISPTGLEGNWATLVPGVGSGIYFENKLIFPAYGGVLPNSSLGVKSAREFFRPVNPYNPCSGPQQDLDQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TBC1D15 Protein
E30P62211B 50 µg

Recombinant Human TBC1D15 Protein

Sign In for Pricing
View Details
Zfand5 Mouse siRNA Oligo Duplex (Locus ID 22682)
SR405642 1 Kit

Zfand5 Mouse siRNA Oligo Duplex (Locus ID 22682)

Sign In for Pricing
View Details
MLLT11 Polyclonal Antibody, FITC Conjugated
A59824-100 100 µL

MLLT11 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
SLFN12 Rabbit Polyclonal Antibody
orb2991632 100 µg

SLFN12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trim62 Mouse qPCR Primer Pair (NM_178110)
MP217599 200 Reactions

Trim62 Mouse qPCR Primer Pair (NM_178110)

Sign In for Pricing
View Details
Recombinant Human CALCRL Protein, N-His
bs-102078P-01 20 µg

Recombinant Human CALCRL Protein, N-His

Sign In for Pricing
View Details