Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G12A protein

This Human PLA2G12A protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (PLA2G12)

UniProt

Q9BZM1

Expression Region

23-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Azide free) (HR
MBS6493214-01 0.2 mL

PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Azide free) (HR

Sign In for Pricing
View Details
PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Azide free) (HR
MBS6493214-02 5x 0.2 mL

PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Azide free) (HR

Sign In for Pricing
View Details
Wnt5a Antibody (PerCP)
orb414050 100 µg

Wnt5a Antibody (PerCP)

Sign In for Pricing
View Details
PRKAR2B, ID (PRKAR2B, cAMP-dependent protein kinase type II-beta regulatory subunit) (APC) discontinued
040444-APC 200 µL

PRKAR2B, ID (PRKAR2B, cAMP-dependent protein kinase type II-beta regulatory subunit) (APC) discontinued

Sign In for Pricing
View Details
Anti-RAGE/AGER Antibody Picoband® (Biotine Conjugate)
PB9469-Biotin 100 µg/Vial

Anti-RAGE/AGER Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
DNAJC15 (DnaJ (Hsp40) Homolog, Subfamily C, Member 15, DNAJD1, HSD18, MCJ)
245445 50 µg

DNAJC15 (DnaJ (Hsp40) Homolog, Subfamily C, Member 15, DNAJD1, HSD18, MCJ)

Sign In for Pricing
View Details