What is the catalog number for Virus YNK1 protein?

The catalog number for Virus YNK1 protein is orb604275.

What sizes are available for Virus YNK1 protein?

Virus YNK1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Virus YNK1 protein come in?

Virus YNK1 protein is available in 3 different pack sizes.

Is Virus YNK1 protein in stock?

Virus YNK1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Virus YNK1 protein

This Virus YNK1 protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDK (NDP kinase) (NDK1) (YNK)

UniProt

P36010

Expression Region

1-153aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE