Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaque-size/host range protein

UniProt

P21115

Expression Region

18-279aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX1P2 Adenovirus (Human)
15129051 1.0 mL

CBX1P2 Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral human CNTNAP5 shRNA (UAS) - Lentiviral human CNTNAP5 shRNA (UAS, iRFP) (25)
GTR15340025 1 Vial

Lentiviral human CNTNAP5 shRNA (UAS) - Lentiviral human CNTNAP5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)
VHB95601 100 μg

InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

Sign In for Pricing
View Details
Recombinant Human ECI1 Protein, His, E.coli-100ug
QP11740-100ug 100ug

Recombinant Human ECI1 Protein, His, E.coli-100ug

Sign In for Pricing
View Details
WDR46 Human qPCR Template Standard (NM_005452)
HK207940 1 Kit

WDR46 Human qPCR Template Standard (NM_005452)

Sign In for Pricing
View Details
Anti-CD15 Antibody
CPA8496-01 30 µL

Anti-CD15 Antibody

Sign In for Pricing
View Details