Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaque-size/host range protein

UniProt

P21115

Expression Region

18-279aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KLHL38 Protein, His (Fc)-Avi-tagged
KLHL38-3227H 50 µg

Recombinant Human KLHL38 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Brivekimig Antibody
orb2803432-01 1 mg

Brivekimig Antibody

Sign In for Pricing
View Details
Brivekimig Antibody
orb2803432-02 5 mg

Brivekimig Antibody

Sign In for Pricing
View Details
Brivekimig Antibody
orb2803432-03 10 mg

Brivekimig Antibody

Sign In for Pricing
View Details
OGFOD1 (8O14) Mouse Monoclonal antibody
E28PE4073 100 µL

OGFOD1 (8O14) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Gab2 (Ab-159) Antibody
orb758336-01 25 µg

Gab2 (Ab-159) Antibody

Sign In for Pricing
View Details