Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaque-size/host range protein

UniProt

P21115

Expression Region

18-279aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PELI1 AAV Vector (Human) (CMV)
36379101 1 µg

PELI1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MBL2 Antibody
OACD05464-100UL 100 µL

MBL2 Antibody

Sign In for Pricing
View Details
ZIK1 Double Nickase Plasmid (m2)
sc-423818-NIC-2 20 µg

ZIK1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Human CHEK2 (-/-); TP53 (+/+) HCT116 Cell Line
ABC-KH3035 1 Vial

Human CHEK2 (-/-); TP53 (+/+) HCT116 Cell Line

Sign In for Pricing
View Details
Anti-IP6K2 Antibody
MBS820403-01 0.03 mL

Anti-IP6K2 Antibody

Sign In for Pricing
View Details
Anti-IP6K2 Antibody
MBS820403-02 0.05 mL

Anti-IP6K2 Antibody

Sign In for Pricing
View Details