Virus Haplopelma schmidti Tau-theraphotoxin-Hs1a protein

Genome polyprotein [Cleaved into, N-terminal protease, N-pro, EC 3.4.22.-, Autoprotease p20), Capsid protein C, E (rns) glycoprotein, gp44/48), Envelope glycoprotein E1, gp33), Envelope glycoprotein E2, gp55), p7, Non-structural protein 2-3, Cysteine protease NS2, EC 3.4.22.-, Non-structural protein 2), Serine protease NS3, EC 3.4.21.113, EC 3.6.1.15, EC 3.6.4.13, Non-structural protein 3), Non-structural protein 4A, NS4A), Non-structural protein 4B, NS4B), Non-structural protein 5A, NS5A), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B) ]

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC