Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LEFTY2 protein

This Human LEFTY2 protein spans the amino acid sequence from region 77-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endometrial bleeding-associated factor (Left-right determination factor A) (Protein lefty-2) (Protein lefty-A) (Transforming growth factor beta-4) (TGF-beta-4) (EBAF) (LEFTA) (LEFTYA) (TGFB4)

UniProt

O00292

Expression Region

77-366aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM14 (Tripartite Motif-containing Protein 14, KIAA0129) (FITC)
MBS6397174-01 0.1 mL

TRIM14 (Tripartite Motif-containing Protein 14, KIAA0129) (FITC)

Sign In for Pricing
View Details
TRIM14 (Tripartite Motif-containing Protein 14, KIAA0129) (FITC)
MBS6397174-02 5x 0.1 mL

TRIM14 (Tripartite Motif-containing Protein 14, KIAA0129) (FITC)

Sign In for Pricing
View Details
Bcl2l15 Rat shRNA Lentiviral Particle (Locus ID 295337)
TL705039V 500 µL Each

Bcl2l15 Rat shRNA Lentiviral Particle (Locus ID 295337)

Sign In for Pricing
View Details
KLF4 (NM_004235) Human Tagged Lenti ORF Clone
RC229235L2 10 µg

KLF4 (NM_004235) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) tyrS Polyclonal Antibody
MBS7168533 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) tyrS Polyclonal Antibody

Sign In for Pricing
View Details
Synaptotagmin I (p65) (FITC) discontinued
S9109-23-FITC 100 µL

Synaptotagmin I (p65) (FITC) discontinued

Sign In for Pricing
View Details