Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LEFTY2 protein

This Human LEFTY2 protein spans the amino acid sequence from region 77-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endometrial bleeding-associated factor (Left-right determination factor A) (Protein lefty-2) (Protein lefty-A) (Transforming growth factor beta-4) (TGF-beta-4) (EBAF) (LEFTA) (LEFTYA) (TGFB4)

UniProt

O00292

Expression Region

77-366aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 1 (ITGB1) Mouse Monoclonal Antibody [Clone ID: DF7]
AM32088PU-N 1 mL

Integrin beta 1 (ITGB1) Mouse Monoclonal Antibody [Clone ID: DF7]

Sign In for Pricing
View Details
Angiotensin II Type 2 Receptor (AGTR2) (NM_000686) Human Tagged Lenti ORF Clone
RC223317L4 10 µg

Angiotensin II Type 2 Receptor (AGTR2) (NM_000686) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Morc2b CRISPRa sgRNA lentivector (set of three targets)(Rat)
30313126 3x 1.0µg DNA

Morc2b CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
RANGE H - Kit for using  without charcol filter
CAR50 each

RANGE H - Kit for using without charcol filter

Sign In for Pricing
View Details
GEF H1 Blocking Peptide
MBS9616772-01 1 mg

GEF H1 Blocking Peptide

Sign In for Pricing
View Details
GEF H1 Blocking Peptide
MBS9616772-02 5x 1 mg

GEF H1 Blocking Peptide

Sign In for Pricing
View Details