Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PML protein

This Human PML protein spans the amino acid sequence from region 59-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Promyelocytic leukemia protein (RING finger protein 71) (Tripartite motif-containing protein 19) (MYL) (PP8675) (RNF71) (TRIM19)

UniProt

P29590

Expression Region

59-239aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM3A (NM_021806) Human Recombinant Protein
TP303495 20 µg

FAM3A (NM_021806) Human Recombinant Protein

Sign In for Pricing
View Details
CCDC47 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2396483 100 µL

CCDC47 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
ZNF266 Antibody - middle region : FITC (ARP38843_P050-FITC)
ARP38843_P050-FITC 100 µL

ZNF266 Antibody - middle region : FITC (ARP38843_P050-FITC)

Sign In for Pricing
View Details
Cyclin G Polyclonal Antibody, PE-Cy7 Conjugated
bs-25631R-PE-Cy7 100 µL

Cyclin G Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
SRC Monoclonal Antibody
bsm-33435M 100 µL

SRC Monoclonal Antibody

Sign In for Pricing
View Details
Caspase 1 antibody
70R-15367 0.1 mg

Caspase 1 antibody

Sign In for Pricing
View Details