Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NKX2-1 protein

This Human NKX2-1 protein spans the amino acid sequence from region 1-371aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Homeobox protein NK-2 homolog A (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) (Thyroid-specific enhancer-binding protein) (T/EBP) (NKX2A) (TITF1) (TTF1)

UniProt

P43699

Expression Region

1-371aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Phytofermentans glyA Protein (aa 1-412)
VAng-Lsx01322-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Phytofermentans glyA Protein (aa 1-412)

Sign In for Pricing
View Details
OR2A5 Protein Lysate
OCOA11520-20UG 20 µg

OR2A5 Protein Lysate

Sign In for Pricing
View Details
Cytokeratin 17 (CK17) Polyclonal Antibody
CAU25238-01 100 µL

Cytokeratin 17 (CK17) Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 17 (CK17) Polyclonal Antibody
CAU25238-02 200 µL

Cytokeratin 17 (CK17) Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 17 (CK17) Polyclonal Antibody
CAU25238-03 1 mL

Cytokeratin 17 (CK17) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD44  (4H2)
YF-MA12345 100 ug

Anti-CD44 (4H2)

Sign In for Pricing
View Details