Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL6A6 protein

This Human COL6A6 protein spans the amino acid sequence from region 430-982aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COL6A6Collagen alpha-6 (VI) chain

UniProt

A6NMZ7

Expression Region

430-982aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMAGSSDKYFFVETFGGLKGIFSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMTM7 3'UTR GFP Stable Cell Line
TU054664 1.0 mL

CMTM7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit
MBS9324044-01 48 Well

Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit

Sign In for Pricing
View Details
Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit
MBS9324044-02 96 Well

Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit

Sign In for Pricing
View Details
Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit
MBS9324044-03 5x 96 Well

Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit

Sign In for Pricing
View Details
Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit
MBS9324044-04 10x 96 Well

Rat Leucine-rich repeat protein SHOC-2, SHOC2 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human NFATc1 Polyclonal Antibody
PA84712HU-01 50 µg

Rabbit Anti-Human NFATc1 Polyclonal Antibody

Sign In for Pricing
View Details