Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL6A6 protein

This Human COL6A6 protein spans the amino acid sequence from region 430-982aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COL6A6Collagen alpha-6 (VI) chain

UniProt

A6NMZ7

Expression Region

430-982aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMAGSSDKYFFVETFGGLKGIFSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb18 Protein Vector (Mouse) (pPM-C-His)
PV171469 500 ng

Defb18 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Myristoyl chloride
FM145125 500 g

Myristoyl chloride

Sign In for Pricing
View Details
Recombinant Rat OSM
P6344-500μg 500 µg

Recombinant Rat OSM

Sign In for Pricing
View Details
RSK2 (phospho-Ser227) rabbit pAb
RA29568-01 50 µL

RSK2 (phospho-Ser227) rabbit pAb

Sign In for Pricing
View Details
RSK2 (phospho-Ser227) rabbit pAb
RA29568-02 100 µL

RSK2 (phospho-Ser227) rabbit pAb

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris Ferredoxin--NADP reductase (Rpal_4475)
MBS1117713-01 0.02 mg (E-Coli)

Recombinant Rhodopseudomonas palustris Ferredoxin--NADP reductase (Rpal_4475)

Sign In for Pricing
View Details