Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant XERO1 protein

This Plant XERO1 protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DHNX

UniProt

P25863

Expression Region

1-128aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL17 AAV siRNA Pooled Vector
15349161 1.0 µg

CCL17 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Acetyl-D-methionine 99+% (HPLC)
235119-01 5 g

Acetyl-D-methionine 99+% (HPLC)

Sign In for Pricing
View Details
Acetyl-D-methionine 99+% (HPLC)
235119-02 25 g

Acetyl-D-methionine 99+% (HPLC)

Sign In for Pricing
View Details
Acetyl-D-methionine 99+% (HPLC)
235119-03 100 g

Acetyl-D-methionine 99+% (HPLC)

Sign In for Pricing
View Details
Lentiviral human PSMA7 shRNA (UAS) - Lentiviral human PSMA7 shRNA (UAS) (25)
GTR15158525 1 Vial

Lentiviral human PSMA7 shRNA (UAS) - Lentiviral human PSMA7 shRNA (UAS) (25)

Sign In for Pricing
View Details
Polyclonal F7 Antibody (C-Term)
APR04982G 0.1ml

Polyclonal F7 Antibody (C-Term)

Sign In for Pricing
View Details