Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile TLF1 protein

This Reptile TLF1 protein spans the amino acid sequence from region 25-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE)

UniProt

P05620

Expression Region

25-260aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd93 (NM_010740) Mouse Tagged ORF Clone Lentiviral Particle
MR222252L4V 200 µL

Cd93 (NM_010740) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr1347-set siRNA/shRNA/RNAi Lentivector (Mouse)
32797094 4x 500 ng

Olfr1347-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 - HRP
orb1786788-01 100 µL

Rabbit Anti-Human IgG F (ab') 2 - HRP

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 - HRP
orb1786788-02 500 µL

Rabbit Anti-Human IgG F (ab') 2 - HRP

Sign In for Pricing
View Details
pLV3-U6-RARRES1-shRNA1-EGFP-Puro Plasmid
PVT57432 2 µg

pLV3-U6-RARRES1-shRNA1-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Mouse Iporin, Rusc2 ELISA KIT
ELI-15672m 96 Tests

Mouse Iporin, Rusc2 ELISA KIT

Sign In for Pricing
View Details