Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile TLF1 protein

This Reptile TLF1 protein spans the amino acid sequence from region 25-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE)

UniProt

P05620

Expression Region

25-260aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Calretinin Antibody
303-CALt 25 µL

Anti-Calretinin Antibody

Sign In for Pricing
View Details
Sodium Acetate solution (1M)
TBS5044 500 mL

Sodium Acetate solution (1M)

Sign In for Pricing
View Details
Bovine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit
GTR10319851 96 Well

Bovine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit

Sign In for Pricing
View Details
Anti-Human B7-H1 / PD-L1 / CD274 (Socazolimab Biosimilar)
BIO0959SM-5mg 5 mg

Anti-Human B7-H1 / PD-L1 / CD274 (Socazolimab Biosimilar)

Sign In for Pricing
View Details
PTGIR (Prostaglandin I2 (prostacyclin) Receptor (IP), IP, MGC102830, PRIPR) (MaxLight 650)
MBS6229471-01 0.1 mL

PTGIR (Prostaglandin I2 (prostacyclin) Receptor (IP), IP, MGC102830, PRIPR) (MaxLight 650)

Sign In for Pricing
View Details
PTGIR (Prostaglandin I2 (prostacyclin) Receptor (IP), IP, MGC102830, PRIPR) (MaxLight 650)
MBS6229471-02 5x 0.1 mL

PTGIR (Prostaglandin I2 (prostacyclin) Receptor (IP), IP, MGC102830, PRIPR) (MaxLight 650)

Sign In for Pricing
View Details