Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile TLF1 protein

This Reptile TLF1 protein spans the amino acid sequence from region 25-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE)

UniProt

P05620

Expression Region

25-260aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Vitamin D BP Antibody (VDBP/4482) [Alexa Fluor 488]
NBP3-14006AF488 0.1 mL

Mouse Monoclonal Vitamin D BP Antibody (VDBP/4482) [Alexa Fluor 488]

Sign In for Pricing
View Details
Methyl 3-phenylpropionate
FM37958 2000 g

Methyl 3-phenylpropionate

Sign In for Pricing
View Details
ASB15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0132508 1.0 µg DNA

ASB15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Dock9 ORF Vector (Mouse) (pORF)
18502014 1.0 µg DNA

Dock9 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Y 14556
MBS5784708 Inquire

Y 14556

Sign In for Pricing
View Details
Mouse Monoclonal Mesothelin Antibody (rMSLN/8764) [Janelia Fluor 669]
NBP3-20892JF669 0.1 mL

Mouse Monoclonal Mesothelin Antibody (rMSLN/8764) [Janelia Fluor 669]

Sign In for Pricing
View Details