Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile TLF1 protein

This Reptile TLF1 protein spans the amino acid sequence from region 25-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE)

UniProt

P05620

Expression Region

25-260aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iodine prills
90029772-25g 25 g

Iodine prills

Sign In for Pricing
View Details
(1S) -1- (3-Methylcyclohexyl) ethan-1-amine hydrochloride
PZC01227-01 50 mg

(1S) -1- (3-Methylcyclohexyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
(1S) -1- (3-Methylcyclohexyl) ethan-1-amine hydrochloride
PZC01227-02 0.5 g

(1S) -1- (3-Methylcyclohexyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
Human HSD17B7 knockout cell line
ABC-KH7034 1 Vial

Human HSD17B7 knockout cell line

Sign In for Pricing
View Details
Mouse Fzd2 (NM_020510) AAV Particle
MR208974A1V 250 µL

Mouse Fzd2 (NM_020510) AAV Particle

Sign In for Pricing
View Details
HP1BP3 antibody - middle region (ARP56875_P050)
ARP56875_P050 100 µL

HP1BP3 antibody - middle region (ARP56875_P050)

Sign In for Pricing
View Details