Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCNMA1 protein

This Human KCNMA1 protein spans the amino acid sequence from region 411-560aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BK channel (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K (VCA) alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (Slowpoke homolog) (Slo homolog) (hSlo) (KCNMA) (SLO)

UniProt

Q12791

Expression Region

411-560aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP2 Recombinant Rabbit mAb, BF350 conjugated
orb2892185 100 µL

LRP2 Recombinant Rabbit mAb, BF350 conjugated

Sign In for Pricing
View Details
CAP1 siRNA (Human)
orb1861134-01 15 nmol

CAP1 siRNA (Human)

Sign In for Pricing
View Details
CAP1 siRNA (Human)
orb1861134-02 30 nmol

CAP1 siRNA (Human)

Sign In for Pricing
View Details
CD126 (Interleukin 6 Receptor, neutralizing, IL-6R) (MaxLight 750) discontinued
C2464-ML750 100 µL

CD126 (Interleukin 6 Receptor, neutralizing, IL-6R) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SMARCD2 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily d, Member 2, BAF60B, CRACD2, PRO2451, Rsc6p)
251851 100 µg

SMARCD2 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily d, Member 2, BAF60B, CRACD2, PRO2451, Rsc6p)

Sign In for Pricing
View Details
Human Fibrinogen Degradation Product (FDP) ELISA Kit
YP-W11593-01 48 Tests

Human Fibrinogen Degradation Product (FDP) ELISA Kit

Sign In for Pricing
View Details