Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ins2 protein

This Mouse Ins2 protein spans the amino acid sequence from region 25-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ins-2

UniProt

P01326

Expression Region

25-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Psmg4 shRNA (UAS) - Lentiviral mouse Psmg4 shRNA (UAS, RFP) (25)
GTR15283259 1 Vial

Lentiviral mouse Psmg4 shRNA (UAS) - Lentiviral mouse Psmg4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
{4-[2- (Pyrrolidin-1-yl) ethoxy]phenyl}methanol
MKA42592-01 50 mg

{4-[2- (Pyrrolidin-1-yl) ethoxy]phenyl}methanol

Sign In for Pricing
View Details
{4-[2- (Pyrrolidin-1-yl) ethoxy]phenyl}methanol
MKA42592-02 0.5 g

{4-[2- (Pyrrolidin-1-yl) ethoxy]phenyl}methanol

Sign In for Pricing
View Details
HENMT1 Recombinant Protein (Rat)
RP204428 100 µg

HENMT1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
5-Chloro-2- (2-methoxyethoxy) aniline
YAA98721-01 250 mg

5-Chloro-2- (2-methoxyethoxy) aniline

Sign In for Pricing
View Details
5-Chloro-2- (2-methoxyethoxy) aniline
YAA98721-02 2.5 g

5-Chloro-2- (2-methoxyethoxy) aniline

Sign In for Pricing
View Details