Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ins2 protein

This Mouse Ins2 protein spans the amino acid sequence from region 25-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ins-2

UniProt

P01326

Expression Region

25-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Mouse Ly6C (Monts1)
MBS7620641-01 50 Tests

PE Anti-Mouse Ly6C (Monts1)

Sign In for Pricing
View Details
PE Anti-Mouse Ly6C (Monts1)
MBS7620641-02 100 Tests

PE Anti-Mouse Ly6C (Monts1)

Sign In for Pricing
View Details
PE Anti-Mouse Ly6C (Monts1)
MBS7620641-03 5x 100 Tests

PE Anti-Mouse Ly6C (Monts1)

Sign In for Pricing
View Details
Anti-SLC7A10 Antibody Picoband® Fluoro550 Conjugated
A09335-2-Fluoro550 100 µg/Vial

Anti-SLC7A10 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
CXCL16 (Chemokine (C-X-C Motif) Ligand 16, CXCLG16, SR-PSOX, SRPSOX) (MaxLight 550)
MBS6216478-01 0.1 mL

CXCL16 (Chemokine (C-X-C Motif) Ligand 16, CXCLG16, SR-PSOX, SRPSOX) (MaxLight 550)

Sign In for Pricing
View Details
CXCL16 (Chemokine (C-X-C Motif) Ligand 16, CXCLG16, SR-PSOX, SRPSOX) (MaxLight 550)
MBS6216478-02 5x 0.1 mL

CXCL16 (Chemokine (C-X-C Motif) Ligand 16, CXCLG16, SR-PSOX, SRPSOX) (MaxLight 550)

Sign In for Pricing
View Details