Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Nuclear export protein (NS) protein

This Virus Nuclear export protein (NS) protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-structural protein 2 (NS2) (NEP)

UniProt

P08014

Expression Region

1-122aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Influenza B virus (strain B/Yamagata/1/1973)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20, Antibody
GWB-68421D 0.1 mL

CD20, Antibody

Sign In for Pricing
View Details
ZNF253 Rabbit Polyclonal Antibody (BF750)
orb2394033 100 µL

ZNF253 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
POU2AF1 Antibody
E19-7859-2 100 µg -100 µL

POU2AF1 Antibody

Sign In for Pricing
View Details
Human PKIB shRNA Plasmid
abx953742-01 150 µg

Human PKIB shRNA Plasmid

Sign In for Pricing
View Details
Human PKIB shRNA Plasmid
abx953742-02 300 µg

Human PKIB shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal LMX1b Antibody [DyLight 650]
NBP2-41194C 0.1 mL

Rabbit Polyclonal LMX1b Antibody [DyLight 650]

Sign In for Pricing
View Details