Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bgn protein

This Mouse Bgn protein spans the amino acid sequence from region 38-369aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone/cartilage proteoglycan I (PG-S1)

UniProt

P28653

Expression Region

38-369aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IGSF4B/SynCAM3/CADM3 Antibody [Alexa Fluor 488]
NBP2-81834AF488 0.1 mL

Rabbit Polyclonal IGSF4B/SynCAM3/CADM3 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
NUBP2 (H-2)
sc-376786 200 µg/mL

NUBP2 (H-2)

Sign In for Pricing
View Details
Y-Oxo-1-pyrenebutanoic Acid-13C4
sc-478788 2.5 mg

Y-Oxo-1-pyrenebutanoic Acid-13C4

Sign In for Pricing
View Details
Sbno1 siRNA Oligos set (Mouse)
43053174 3x 5 nmol

Sbno1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
SYT12 Protein Lysate (Human) with C-Ha Tag
45996031 100 µg

SYT12 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
C21orf77 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14351061 1.0 µg DNA

C21orf77 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details