Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus E4 protein

This Virus E4 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E1^E4

UniProt

P06922

Expression Region

1-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human papillomavirus type 16

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADPAAATKYPLLKLLGSTWPTTPPRPIPKPSPWAPKKHRRLSSDQDQSQTPETPATPLSCCTETQWTVLQSSLHLTAHTKDGLTVIVTLHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTH Protein, Human, Recombinant (hFc)
TMPY-03191-01 5 µg

PTH Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
PTH Protein, Human, Recombinant (hFc)
TMPY-03191-02 10 µg

PTH Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
PTH Protein, Human, Recombinant (hFc)
TMPY-03191-03 20 µg

PTH Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
PTH Protein, Human, Recombinant (hFc)
TMPY-03191-04 50 µg

PTH Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
PTH Protein, Human, Recombinant (hFc)
TMPY-03191-05 100 µg

PTH Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
PTH Protein, Human, Recombinant (hFc)
TMPY-03191-06 200 µg

PTH Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details