Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pde5a protein

This Mouse Pde5a protein spans the amino acid sequence from region 154-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)

UniProt

Q8CG03

Expression Region

154-320aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r47 Recombinant Protein (Rat)
RP236858 100 µg

Vom2r47 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (PE)
168874-AF-PE 100 µL

Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (PE)

Sign In for Pricing
View Details
Anti-Twinkle/TWNK Antibody Picoband® HRP Conjugated
A32117-HRP 100 µg/Vial

Anti-Twinkle/TWNK Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
hsa-miR-6755-5p Primers
MPH03534 150 µL / 10 µM

hsa-miR-6755-5p Primers

Sign In for Pricing
View Details
BPIFB1 Rabbit Polyclonal Antibody (Biotin)
orb2582452 100 µg

BPIFB1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human UBE3C Protein Lysate
MBS8429450-01 0.02 mg

Human UBE3C Protein Lysate

Sign In for Pricing
View Details