Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pmaip1 protein

This Mouse Pmaip1 protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Noxa (Noxa)

UniProt

Q9JM54

Expression Region

1-103aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2C3, CT (OR2C3, OR2C4, OR2C5P, Olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30) (Biotin)
MBS6328373-01 0.2 mL

OR2C3, CT (OR2C3, OR2C4, OR2C5P, Olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30) (Biotin)

Sign In for Pricing
View Details
OR2C3, CT (OR2C3, OR2C4, OR2C5P, Olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30) (Biotin)
MBS6328373-02 5x 0.2 mL

OR2C3, CT (OR2C3, OR2C4, OR2C5P, Olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30) (Biotin)

Sign In for Pricing
View Details
1600014K23Rik Protein Vector (Mouse) (pPB-N-His)
PV146655 500 ng

1600014K23Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Chicken Total Leukotriene ELISA Kit
MBS745427-01 48 Well

Chicken Total Leukotriene ELISA Kit

Sign In for Pricing
View Details
Chicken Total Leukotriene ELISA Kit
MBS745427-02 96 Well

Chicken Total Leukotriene ELISA Kit

Sign In for Pricing
View Details
Chicken Total Leukotriene ELISA Kit
MBS745427-03 5x 96 Well

Chicken Total Leukotriene ELISA Kit

Sign In for Pricing
View Details