Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEBPD protein

This Human CEBPD protein spans the amino acid sequence from region 2-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear factor NF-IL6-beta (NF-IL6-beta) (C/EBP delta)

UniProt

P49716

Expression Region

2-269aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial
MBS1439639-01 0.5 mg (E-Coli)

Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial

Sign In for Pricing
View Details
Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial
MBS1439639-02 0.05 mg (Baculovirus)

Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial

Sign In for Pricing
View Details
Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial
MBS1439639-03 0.5 mg (Yeast)

Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial

Sign In for Pricing
View Details
Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial
MBS1439639-04 0.05 mg (Mammalian-Cell)

Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial

Sign In for Pricing
View Details
Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial
MBS1439639-05 1 mg (E-Coli)

Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial

Sign In for Pricing
View Details
Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial
MBS1439639-06 0.1 mg (Baculovirus)

Recombinant Mouse Zona pellucida-like domain-containing protein 1 (Zpld1), partial

Sign In for Pricing
View Details