Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate FASLG protein

This Primate FASLG protein spans the amino acid sequence from region 102-280aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen, CD178) (CD95L) (FASL) (TNFSF6)

UniProt

P63308

Expression Region

102-280aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TCEA1 Pre-designed siRNA Set A
SI016362A 1 Each

Human TCEA1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Human CD243/ABCB1 Antibody (MRK16)
MBS1570003-01 0.05 mg

Anti-Human CD243/ABCB1 Antibody (MRK16)

Sign In for Pricing
View Details
Anti-Human CD243/ABCB1 Antibody (MRK16)
MBS1570003-02 0.1 mg

Anti-Human CD243/ABCB1 Antibody (MRK16)

Sign In for Pricing
View Details
Anti-Human CD243/ABCB1 Antibody (MRK16)
MBS1570003-03 5x 0.1 mg

Anti-Human CD243/ABCB1 Antibody (MRK16)

Sign In for Pricing
View Details
SNX20 Protein Vector (Human) (pPM-C-His)
PV039480 500 ng

SNX20 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Goat Ficolin 3 ELISA Kit
MBS054052 Inquire

Goat Ficolin 3 ELISA Kit

Sign In for Pricing
View Details