Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate FASLG protein

This Primate FASLG protein spans the amino acid sequence from region 102-280aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen, CD178) (CD95L) (FASL) (TNFSF6)

UniProt

P63308

Expression Region

102-280aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-1306-3p miRNA Agomir
CMJ0820-01 5 nmol

Hsa-miR-1306-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-1306-3p miRNA Agomir
CMJ0820-02 10 nmol

Hsa-miR-1306-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-1306-3p miRNA Agomir
CMJ0820-03 20 nmol

Hsa-miR-1306-3p miRNA Agomir

Sign In for Pricing
View Details
Human DDC Protein, His Tag
KMPH2190-01 10 µg

Human DDC Protein, His Tag

Sign In for Pricing
View Details
Human DDC Protein, His Tag
KMPH2190-02 50 µg

Human DDC Protein, His Tag

Sign In for Pricing
View Details
3- (N-Propylaminocarbonyl) methylphenylboronic acid, pinacol ester
423314-01 100 mg

3- (N-Propylaminocarbonyl) methylphenylboronic acid, pinacol ester

Sign In for Pricing
View Details