Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifna7 protein

This Mouse Ifna7 protein spans the amino acid sequence from region 24-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-alpha-7 (Ifa7)

UniProt

P06799

Expression Region

24-190aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM104B AAV Vector (Human) (CMV)
19686101 1 µg

FAM104B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
C1QTNF10 Polyclonal Antibody, Cy5.5 Conjugated
bs-9793R-Cy5.5 100 µL

C1QTNF10 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
DBH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0562606 1.0 µg DNA

DBH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Polyclonal Antibody to Serum Amyloid A (SAA)
MBS2112031-01 0.1 mL

Polyclonal Antibody to Serum Amyloid A (SAA)

Sign In for Pricing
View Details
Polyclonal Antibody to Serum Amyloid A (SAA)
MBS2112031-02 0.2 mL

Polyclonal Antibody to Serum Amyloid A (SAA)

Sign In for Pricing
View Details
Polyclonal Antibody to Serum Amyloid A (SAA)
MBS2112031-03 0.5 mL

Polyclonal Antibody to Serum Amyloid A (SAA)

Sign In for Pricing
View Details